Bacterial taxon 208964
Protein WP_003094769.1
FKBP-type peptidyl-prolyl cis-trans isomerase
Pseudomona aeruginosa PA01
Gene fklB, UniProt Q9HVL2
>WP_003094769.1|Pseudomona aeruginosa PA01|FKBP-type peptidyl-prolyl cis-trans isomerase
MSELNLTTDEARVSYGIGRQLGDQLRENPVPGMTLDAVLAGLSDAFAGIDSRVSGEALSASFQVIRERMQAEAQAKAEAAAGEGRAYLAENAKREGVTVLPSGLQFEVLSTGEGAKPSREDTVRTHYHGTLIDGTVFDSSYQRGQPAEFPVGGVIAGWVEALQLMNAGSKWRLHVPSELAYGGQAVGSIPPHSVLVFDVELLEIL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.95 | 0.949617584313995 | 1.7e-47 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)