Host taxon 10090
Protein NP_796049.1
fibronectin type III domain-containing protein 9
Mus musculus
Gene Fndc9, UniProt Q8BJN4
>NP_796049.1|Pseudomona aeruginosa PA01|fibronectin type III domain-containing protein 9
MNIEVGNVSHTGAIISWSPSEPCLEDYYHIMYRPNWNSIFSGYLRYNFHHEEKVPRTITSVALEHLAPSTLYFLCISCKKAAFPYSHYCTMFHTLDKSPLAAGGSLVDPQISLWVLMAILLACFTAVLAFICLQFWCLRCHEPRWSYRAGQMEEANGLVRWPEETPALGQREEDLQGFPLEELPRKNSGARAKAEPEAEAIQDALEVVALAREIGNQPAILPHYRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.14 | 1.14135791204171 | 0.046 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)