Host taxon 10090
Protein NP_034327.1
fibroblast growth factor 1
Mus musculus
Gene Fgf1, UniProt P61148
>NP_034327.1|Pseudomona aeruginosa PA01|fibroblast growth factor 1
MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.36 | -0.356772385832238 | 2.6e-6 | 32071273 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)