Host taxon 10090
Protein NP_034764.1
fatty acid-binding protein 5 isoform 1
Mus musculus
Gene Fabp5, UniProt Q05816
>NP_034764.1|Pseudomona aeruginosa PA01|fatty acid-binding protein 5 isoform 1
MASLKDLEGKWRLMESHGFEEYMKELGVGLALRKMAAMAKPDCIITCDGNNITVKTESTVKTTVFSCNLGEKFDETTADGRKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRVYEKVQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.88 | -0.877985983100545 | 0.00049 | 32071273 | |
Retrieved 1 of 2 entries in 2.3 ms
(Link to these results)