Host taxon 10090
Protein NP_775573.1
fat storage-inducing transmembrane protein 2
Mus musculus
Gene Fitm2, UniProt P59266
>NP_775573.1|Pseudomona aeruginosa PA01|fat storage-inducing transmembrane protein 2
MEHLERCAWFLRGTLVRATVRRHLPWALVAAMLAGSVVKELSPLPESYLSNKRNVLNVYFVKLAWAWTVCLLLPFIALTNYHLTGKTSLVLRRLSTLLVGTAIWYICTALFSNIEHYTGSCYQSPALEGIRQEHRSKQQCHREGGFWHGFDISGHSFLLTFCALMIVEEMAVLHEVKTDRGHHLHAAITTLVVALGFLTFIWVWMFLCTAVYFHDLTQKVFGTMFGLLGWYGTYGYWYLKSFSPGLPPQSCSLTLKRDTYKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.78 | -0.775536111634467 | 0.017 | 32071273 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)