Host taxon 10090
Protein NP_001158244.1
F-box/WD repeat-containing protein 2 isoform 4
Mus musculus
Gene Fbxw2, UniProt Q9CPQ6
>NP_001158244.1|Pseudomona aeruginosa PA01|F-box/WD repeat-containing protein 2 isoform 4
MERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLLPLELSFYLLKWLDPQTLLTCCLVSKQWNKVISACTEVWQTACKNLGWQIDDSVQDSLHWKKVYLKAILRMKQLEDHEAFETSSLIGHSARVYALYYKDGLLCTGSDDLSAKLWDVSTGQCVYGIQTHTCAAVKFDEQKLVTGSFDNTVACWEWSSGARTQHFRGHTGAGVFSFFKNLYSYFSHAL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.62 | 0.617602680397906 | 2.5e-7 | 32071273 | |
Retrieved 1 of 5 entries in 0.7 ms
(Link to these results)