Host taxon 10090
Protein NP_079662.1
F-box only protein 36
Mus musculus
Gene Fbxo36, UniProt Q9CQ24
>NP_079662.1|Pseudomona aeruginosa PA01|F-box only protein 36
MASWLPETLFEIVGQGPAPSKDYYQLLITRTQIIFRWWKISLRSEYRSAKPGETKESHEDFLDNSHLQVQVAVVFGTKILDYVFNLCEGKFDYLERLSDRLLLKIICYLDLEDIASLSQTSSKFEKLCKSDLLWEQIVQSTCDTITPDMRALAKNMGWRQMFLTNNIQLQRQTRKKKQRQENQAEKLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.45 | -1.45288009441241 | 0.022 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)