Host taxon 10090
Protein NP_034254.1
eukaryotic translation initiation factor 4E-binding protein 2
Mus musculus
Gene Eif4ebp2, UniProt P70445
>NP_034254.1|Pseudomona aeruginosa PA01|eukaryotic translation initiation factor 4E-binding protein 2
MSASAGGSHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.83 | -0.827138363564962 | 3.0e-6 | 32071273 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)