Host taxon 10090
Protein NP_001034259.1
eukaryotic translation initiation factor 4E type 2 isoform 1
Mus musculus
Gene Eif4e2, UniProt Q8BMB3
>NP_001034259.1|Pseudomona aeruginosa PA01|eukaryotic translation initiation factor 4E type 2 isoform 1
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.66 | 0.658278304887483 | 4.0e-5 | 32071273 | |
Retrieved 1 of 5 entries in 2 ms
(Link to these results)