Host taxon 10090
Protein NP_031943.3
eukaryotic translation initiation factor 4E isoform 1
Mus musculus
Gene Eif4e, UniProt P63073
>NP_031943.3|Pseudomona aeruginosa PA01|eukaryotic translation initiation factor 4E isoform 1
MATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.74 | 0.738721777698253 | 1.8e-7 | 32071273 | |
Retrieved 1 of 4 entries in 1.2 ms
(Link to these results)