Host taxon 10090
Protein NP_081168.1
eukaryotic translation initiation factor 1b
Mus musculus
Gene Eif1b, UniProt Q9CXU9
>NP_081168.1|Pseudomona aeruginosa PA01|eukaryotic translation initiation factor 1b
MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.93 | -0.929006632980399 | 0.015 | 32071273 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)