Host taxon 10090
Protein NP_034250.3
eukaryotic translation initiation factor 1A isoform 2
Mus musculus
Gene Eif1a, UniProt Q60872
>NP_034250.3|Pseudomona aeruginosa PA01|eukaryotic translation initiation factor 1A isoform 2
MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVRRLCHIRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.83 | 1.83077836366269 | 7.2e-76 | 32071273 | |
Retrieved 1 of 2 entries in 1.4 ms
(Link to these results)