Host taxon 10090
Protein NP_035638.1
eukaryotic translation initiation factor 1
Mus musculus
Gene Eif1, UniProt P48024
>NP_035638.1|Pseudomona aeruginosa PA01|eukaryotic translation initiation factor 1
MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIEIGLAKDDQLKVHGF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.19 | 2.19188804882613 | 2.3e-253 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)