Host taxon 10090
Protein NP_001309194.1
ETS domain-containing protein Elk-3 isoform Elk3c
Mus musculus
Gene Elk3, UniProt P41971
>NP_001309194.1|Pseudomona aeruginosa PA01|ETS domain-containing protein Elk-3 isoform Elk3c
MESAITLWQFLLHLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDKNIIKKVIGQKFVYKFVSFPDILKMDPHAVEISRESLLLQDGDCKVSPEGREVHRHGLSSLKSASRNEYLHSGLYSSFTINSLQNAPEAFKAIKTEKLEEPCDDSPPVEEVRTVIRHQVDCFWPRVRCCPAYTSGAALVLSPH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.76 | -1.75855867767507 | 6.0e-44 | 32071273 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)