Host taxon 10090
Protein NP_081190.1
essential MCU regulator, mitochondrial precursor
Mus musculus
Gene Smdt1, UniProt Q9DB10
>NP_081190.1|Pseudomona aeruginosa PA01|essential MCU regulator, mitochondrial precursor
MASTAARRLAWVAVRPGALWSGPRGRRGGDVYTVPGSSGLSQVPSRSVIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.53 | -0.534181992898212 | 0.02 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)