Host taxon 10090
Protein NP_080117.1
ER lumen protein-retaining receptor 2
Mus musculus
Gene Kdelr2, UniProt Q9CQM2
>NP_080117.1|Pseudomona aeruginosa PA01|ER lumen protein-retaining receptor 2
MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.48 | -0.482773975047025 | 0.00067 | 32071273 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)