Host taxon 10090
Protein NP_034237.3
ephrin-A1 isoform 1 precursor
Mus musculus
Gene Efna1, UniProt P52793
>NP_034237.3|Pseudomona aeruginosa PA01|ephrin-A1 isoform 1 precursor
MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYSAAPRLFPLVWAVLLLPLLLLQSQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.56 | -1.56444467304461 | 3.2e-22 | 32071273 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)