Host taxon 10090
Protein NP_079889.2
EP300-interacting inhibitor of differentiation 1
Mus musculus
Gene Eid1, UniProt Q9DCR4
>NP_079889.2|Pseudomona aeruginosa PA01|EP300-interacting inhibitor of differentiation 1
MAEMAELCELYEESNELQMDVLPGEGYMEVGRGARGPAPEEGPMEEEAGPAAARAQRGLFPEAGADLEGDEFDDWEDDYEFPEEERWSGAMHRVSAALEEANKVFLRTARAGDALDGGFQARCEKSPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.3 | -1.29644481986419 | 7.3e-13 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)