Host taxon 10090
Protein NP_001241683.1
enoyl-CoA hydratase domain-containing protein 2, mitochondrial isoform 2
Mus musculus
Gene Echdc2, UniProt Q3TLP5
>NP_001241683.1|Pseudomona aeruginosa PA01|enoyl-CoA hydratase domain-containing protein 2, mitochondrial isoform 2
MSDVEVGTFVQRLRGLMSEIAAFPVPTIAAMDGFALGGGLELALACDLRIAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLNGAQARELGLVNHAVAQNEEGNAAYHRALALAQEILPQAPIAVRLGKVAIDRGMEVDIASGMAIEQMCYAQNIPTQDRLEGMAAFREKRAPKFVGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.2 | -1.20147944835248 | 0.001 | 32071273 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)