Host taxon 10090
Protein NP_001263279.1
enhancer of polycomb homolog 1 isoform 3
Mus musculus
Gene Epc1, UniProt Q8C9X6
>NP_001263279.1|Pseudomona aeruginosa PA01|enhancer of polycomb homolog 1 isoform 3
MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEESVQPLIQGAVC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.33 | 0.3310640342155 | 0.032 | 32071273 | |
Retrieved 1 of 5 entries in 0.7 ms
(Link to these results)