Host taxon 10090
Protein NP_034234.1
endothelin-1 preproprotein
Mus musculus
Gene Edn1, UniProt P22387
>NP_034234.1|Pseudomona aeruginosa PA01|endothelin-1 preproprotein
MDYFPVIFSLLFVTFQGAPETAVLGAELSTGAENGVQSPPPSTPWRPRRSKRCSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGGSSRSKRSLKDLLPNKATDQAVRCQCAHQKDKKCWNFCQAGKELRAQSTMQKSLKDSKKGKPCSKLGKKCIYQQLVEGRKLRRLEAISNSIKASFRVAKLKAELYRDQKLTHNRAH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.39 | 2.38805749778523 | 5.1e-137 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)