Host taxon 10090
Protein NP_083208.1
ELL-associated factor 1
Mus musculus
Gene Eaf1, UniProt Q9D4C5
>NP_083208.1|Pseudomona aeruginosa PA01|ELL-associated factor 1
MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSKIQARMEQQPARPPQPSQPPPPPPPMPFRAPTKPPAGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSAGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSSQLMNTLRNDLQLSESGSDSDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.23 | 1.22993031338707 | 3.5e-28 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)