Host taxon 10090
Protein NP_001157100.1
electron transfer flavoprotein regulatory factor 1
Mus musculus
Gene Etfrf1, UniProt Q91V16
>NP_001157100.1|Pseudomona aeruginosa PA01|electron transfer flavoprotein regulatory factor 1
MANSLRGEVLTLYKNLLYLGRDYPKGADYFKRRLKNVFLKNKDVEDPEKIKELIARGEFVMKELEALYFLRKYRAMKQRYYSDTKV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.04 | 2.03856661872065 | 0.039 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)