Host taxon 10090
Protein NP_001076016.1
EG433016 protein
Mus musculus
Gene Cstdc4, UniProt B2RV77
>NP_001076016.1|Pseudomona aeruginosa PA01|EG433016 protein
MMPGGLSRARSATPEIQEIADKVKSLLEEKTNEKYEVFKAVEYKSQVVAGQNYFIKMDVGGGCFLHIKVFKGISGENVLELHGYQTNKTRKDELSYF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.96 | 5.96492457540456 | 2.8e-49 | 32071273 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)