Host taxon 10090
Protein NP_080045.1
EF-hand calcium-binding domain-containing protein 1
Mus musculus
Gene Efcab1, UniProt Q9D3N2
>NP_080045.1|Pseudomona aeruginosa PA01|EF-hand calcium-binding domain-containing protein 1
MNRKKLQKLTDTLTKNCKHFDKFEVKCLITLFYNLVGDVAERPGVVTGLDRNVFRNILHVTFGMTDDMIMDRVFRGFDKDNDGCISVSEWIHGLSLFLRGTLDEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFVDYEKAVREENLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.68 | -2.67715622118995 | 1.5e-7 | 32071273 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)