Host taxon 10090
Protein NP_001289934.1
E3 ubiquitin-protein ligase RNF138 isoform 3
Mus musculus
Gene Rnf138, UniProt Q9CQE0
>NP_001289934.1|Pseudomona aeruginosa PA01|E3 ubiquitin-protein ligase RNF138 isoform 3
MLFKKDYILTNNLQIKFYRMRHHYKSCKKYQDEYGVSSVIPNFKISQDSVRSSNRSETSASDNTETYQEDTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVNLQLDEETQYQTAVEESFQVNM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.04 | 1.03639631184244 | 1.9e-6 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)