Host taxon 10090
Protein NP_083908.1
E3 ubiquitin-protein ligase PPP1R11
Mus musculus
Gene Ppp1r11, UniProt Q8K1L5
>NP_083908.1|Pseudomona aeruginosa PA01|E3 ubiquitin-protein ligase PPP1R11
MAETGAGISETVTETTVTETTVTETTEPENQSLTMKLRKRKPEKKVEWSSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEDEEEGCSHKHCVRGHRKGRRPTTPAPTPTTPPQPPDPSKPPPGPMQH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.76 | 5.76481601802413 | 0.0014 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)