Host taxon 10090
Protein NP_080251.3
dynein light chain Tctex-type 3
Mus musculus
Gene Dynlt3, UniProt P56387
>NP_080251.3|Pseudomona aeruginosa PA01|dynein light chain Tctex-type 3
MEGYQRPCDEVGFNADEAHNIVKECVDGVLGGNDYNENNINQWTASIVEQSITHLVKLGKAYKYIVTCAVVQRSPYGFHTASSCFWDTTSDGTCTIRWENRTMNCIVNVFAVAIVL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.49 | -0.486496646326378 | 0.00096 | 32071273 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)