Host taxon 10090
Protein NP_080223.2
dynein light chain roadblock-type 1 isoform b
Mus musculus
Gene Dynlrb1, UniProt P62627
>NP_080223.2|Pseudomona aeruginosa PA01|dynein light chain roadblock-type 1 isoform b
MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.02 | -1.01957624032222 | 3.6e-7 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)