Host taxon 10090
Protein NP_059498.2
dynein light chain 4, axonemal
Mus musculus
Gene Dnal4, UniProt Q9DCM4
>NP_059498.2|Pseudomona aeruginosa PA01|dynein light chain 4, axonemal
MGETEGKKEEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.51 | -1.5102328256882 | 2.2e-6 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)