Host taxon 10090
Protein NP_062656.3
dynein light chain 1, cytoplasmic
Mus musculus
Gene Dynll1, UniProt P63168
>NP_062656.3|Pseudomona aeruginosa PA01|dynein light chain 1, cytoplasmic
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.62 | -2.61929219479224 | 8.3e-50 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)