Host taxon 10090
Protein NP_001333457.1
dynein light chain 1, axonemal isoform 2
Mus musculus
Gene Dnal1, UniProt Q05A62
>NP_001333457.1|Pseudomona aeruginosa PA01|dynein light chain 1, axonemal isoform 2
MDASLSTLGNCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTPVIKEDEEEES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.66 | -0.66467474876768 | 0.0099 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)