Host taxon 10090
Protein NP_067621.3
dynactin subunit 5
Mus musculus
Gene Dctn5, UniProt Q9QZB9
>NP_067621.3|Pseudomona aeruginosa PA01|dynactin subunit 5
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIIMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.82 | -0.819924391759768 | 0.00035 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)