Host taxon 10090
Protein NP_081001.1
dual specificity protein phosphatase 23
Mus musculus
Gene Dusp23, UniProt Q6NT99
>NP_081001.1|Pseudomona aeruginosa PA01|dual specificity protein phosphatase 23
MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDQGVRHLVSLTERGPPHSDSCPGLTLHRMRIPDFCPPSPEQIDQFVKIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERALAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.58 | -2.57536729450614 | 0.0091 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)