Host taxon 10090
Protein NP_001033044.1
dual specificity protein phosphatase 22 isoform a
Mus musculus
Gene Dusp22, UniProt Q99N11
>NP_001033044.1|Pseudomona aeruginosa PA01|dual specificity protein phosphatase 22 isoform a
MGSGMSQILPGLYIGNFKDARDAEQLSRNKVTHILSVHDTARPMLEGVKYLCIPAADTPSQNLTRHFKESIKFIHECRLQGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNLGFQRQLQEFEKHEVHQYRQWLREEYGENPLRDAEEAKNILGKYKEQGRMEPRPSSRRWSSFSTLPPLTYNNYTTET
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.99 | -1.98810237704695 | 5.9e-10 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)