Host taxon 10090
Protein NP_062793.2
dual specificity protein phosphatase 14
Mus musculus
Gene Dusp14, UniProt Q9JLY7
>NP_062793.2|Pseudomona aeruginosa PA01|dual specificity protein phosphatase 14
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRASVASNWHLLQARGITCVINATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQLFGKSSVKMVQTPYGIIPDVYEKESRHLMPYWGI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.31 | -1.30590235809916 | 4.3e-7 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)