Host taxon 10090
Protein NP_001040898.1
DPH3 homolog isoform 2
Mus musculus
Gene Dph3, UniProt Q8K0W9
>NP_001040898.1|Pseudomona aeruginosa PA01|DPH3 homolog isoform 2
MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFAITKDQFMCGETVPAPSTNKELVKC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.69 | 0.691093037842536 | 0.00089 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)