Host taxon 10090
Protein NP_001277437.1
dolichyldiphosphatase 1 isoform b
Mus musculus
Gene Dolpp1, UniProt Q9JMF7
>NP_001277437.1|Pseudomona aeruginosa PA01|dolichyldiphosphatase 1 isoform b
MPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVFYGGVAGSLMAVAWFIITQEILTPLFPRIAAWPISEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.94 | -0.942147346332489 | 0.0073 | 32071273 | |
Retrieved 1 of 3 entries in 1.1 ms
(Link to these results)