Host taxon 10090
Protein NP_001132975.1
DNL-type zinc finger protein isoform 2
Mus musculus
Gene Dnlz, UniProt Q9D113
>NP_001132975.1|Pseudomona aeruginosa PA01|DNL-type zinc finger protein isoform 2
MLRTALSRMPTLLRSVRTRDSGPRRLWDLGARLKTAERLRGWAWGWASGWRSSSSAPGSGRAAALGRVEADHYQLVYTCKEY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.46 | -1.45794098714767 | 6.1e-5 | 32071273 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)