Host taxon 10090
Protein NP_079869.1
DNA-directed RNA polymerases I, II, and III subunit RPABC5
Mus musculus
Gene Polr2l, UniProt P62876
>NP_079869.1|Pseudomona aeruginosa PA01|DNA-directed RNA polymerases I, II, and III subunit RPABC5
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.97 | 0.970647285108154 | 0.024 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)