Host taxon 10090
Protein NP_031787.1
DNA-directed RNA polymerase III subunit RPC9
Mus musculus
Gene Crcp, UniProt O35427
>NP_031787.1|Pseudomona aeruginosa PA01|DNA-directed RNA polymerase III subunit RPC9
MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSAGQQNLNAITYETLKYISKTPCRNQSPAIVQEFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAGPEDEQSKSTSNDVAMEEEEPA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.07 | -1.06685376097278 | 0.0074 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)