Host taxon 10090
Protein NP_081278.1
DNA-directed RNA polymerase II subunit RPB4 isoform 1
Mus musculus
Gene Polr2d, UniProt Q9D7M8
>NP_081278.1|Pseudomona aeruginosa PA01|DNA-directed RNA polymerase II subunit RPB4 isoform 1
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.97 | 0.965968232032249 | 0.013 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)