Host taxon 10090
Protein NP_084474.1
DNA replication complex GINS protein PSF3
Mus musculus
Gene Gins3, UniProt Q9CY94
>NP_084474.1|Pseudomona aeruginosa PA01|DNA replication complex GINS protein PSF3
MSEAYFPVESGALGPEENFLSLDDILMSQEKLPVRVETPMPRLGAFFLERGAGSEPDHPLPQGTKLELPLWLAKGLFDHKRRILSVELPKMYQEGWRTVFSADANVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLKTFIGRFRRIMDSSQNSYNEDTSALVARLDETERGLFQIGQRSLNDFQSWEKGQASQITASSLVQNYKKRKFTNMED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.5 | -1.50077635200576 | 0.02 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)