Host taxon 10090
Protein NP_001277481.1
DNA repair protein SWI5 homolog isoform a
Mus musculus
Gene Swi5, UniProt Q8K3D3
>NP_001277481.1|Pseudomona aeruginosa PA01|DNA repair protein SWI5 homolog isoform a
MGSRGGTALTWGESEFSRLYHGGYRSPQRPFPMIDENNDVSEEALSSDIKKLKEKHDMLDKEISQLIAEGYRVIELEKHISLLHEYNDIKDVSQMLLGKLAVTRGVTTKELYPDFDLNLND
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.03 | -1.03203997843862 | 9.5e-5 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)