Host taxon 10090
Protein NP_001277416.1
distal membrane-arm assembly complex protein 2 isoform 1
Mus musculus
Gene Dmac2, UniProt Q9D7K5
>NP_001277416.1|Pseudomona aeruginosa PA01|distal membrane-arm assembly complex protein 2 isoform 1
MAAPRAVLHLGAREWNGRARRIHGMSELVTPDSSREKKRTLLQFLSDHFQDIQTLREYLLQKQISKVNRENRSFTNIQEKYGPYVAGAVFILKQGGAVKFQDKEEWIRPNNRSHFLAEIQKFQNVPVEAVDASGCAINYQGLSNLLPLKELRSLSLQRCPNLDDWCLSRLYLLAGSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSHPGLTQILVEEMLPHCEVLGADWAQNLKLEPDKQPPDTSTPLSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.89 | -0.887705389655833 | 0.016 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)