Host taxon 10090
Protein NP_081469.2
diphthine methyl ester synthase
Mus musculus
Gene Dph5, UniProt Q9CWQ0
>NP_081469.2|Pseudomona aeruginosa PA01|diphthine methyl ester synthase
MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLILADREEVEQEADNIFKDADVSDVAFLVVGDPFGATTHSDLILRATKLGIPYQVIHNASIMNAVGCCGLQLYRFGETVSIVFWTDTWRPESFFDKVKRNRANGMHTLCLLDIKVKEQSLENLIRGRKIYEPPRYMSVNQAAQQLLEIVQNHRARGEEPAITEETLCVGLARVGAEDQKIAAGTLQQMCTVSLGEPLHSLVITGGNLHPLEMEMLSLFSIPESQSTDGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.11 | 2.10633466941514 | 5.3e-12 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)