Host taxon 10090
Protein NP_081998.3
diphosphoinositol polyphosphate phosphohydrolase 2 isoform 2
Mus musculus
Gene Nudt4, UniProt Q8R2U6
>NP_081998.3|Pseudomona aeruginosa PA01|diphosphoinositol polyphosphate phosphohydrolase 2 isoform 2
MKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPTNGNSSVPSLPDNNALFVTAAPPSGVPSSIR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.7 | 0.697740270030049 | 9.4e-16 | 32071273 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)