Bacterial taxon 208964
Protein WP_003099587.1
dihydroneopterin aldolase
Pseudomona aeruginosa PA01
Gene folB, UniProt Q9I5V5
>WP_003099587.1|Pseudomona aeruginosa PA01|dihydroneopterin aldolase
MDRVFIEGLEVDTVIGVYDWERGIRQCLRLDLTLGWDNRPAAAGDDLALALDYAALSERVQEFARESHFQLVETFAERLAEVLMGERGIPWLRIRVTKPGAVPAARGVGVEIERGCR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ 1.37 | 1.37323377999275 | 1.2e-6 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)