Host taxon 10090
Protein NP_001278794.1
diamine acetyltransferase 1 isoform 2
Mus musculus
Gene Sat1, UniProt P48026
>NP_001278794.1|Pseudomona aeruginosa PA01|diamine acetyltransferase 1 isoform 2
MYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAAEE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.52 | 1.51963629670206 | 1.1e-74 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)