Host taxon 10090
Protein NP_598856.1
desumoylating isopeptidase 1 isoform 1
Mus musculus
Gene Desi1, UniProt Q9CQT7
>NP_598856.1|Pseudomona aeruginosa PA01|desumoylating isopeptidase 1 isoform 1
MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSSGISSCTPGGTLLGPPDSVVDVGNTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPFLDSIQIQPPGGNSVGRPNGQS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.62 | 0.623018652346295 | 0.0011 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)